Source profileQuality 92/100Review permissions

synthetic-sciences/openscience/backend/cli/skills/biology/gget/SKILL.md

gget

Fast CLI/Python queries to 20+ bioinformatics databases. Use for quick lookups: gene info, BLAST searches, AlphaFold structures, enrichment analysis. Best for interactive exploration, simple queries. For batch processing or advanced BLAST use biopython; for multi-database Python workflows use bioservices.

Source repository stars
3,352
Declared platforms
0
Static risk flags
2
Last source update
2026-08-28
Source checked
2026-08-28

Decision brief

What it does: where it fits

Fast CLI/Python queries to 20+ bioinformatics databases. Use for quick lookups: gene info, BLAST searches, AlphaFold structures, enrichment analysis.

Best for

    Not for

    • Tasks that require unconfirmed production actions or broad system permissions.
    • Environments where the pinned source and install steps cannot be inspected.

    Compatibility matrix

    Platform support, with evidence labels

    PlatformStatusEvidenceWhat to check
    CodexNot declaredNo explicit evidencePortability before use
    Claude CodeNot declaredNo explicit evidencePortability before use
    CursorNot declaredNo explicit evidencePortability before use
    Gemini CLINot declaredNo explicit evidencePortability before use
    Open the compatibility checker

    Installation

    Inspect first. Install second.

    The source command is displayed only when detected. A safe inspection prompt is always available so your agent can explain every action before execution.

    Source-detected install commandSource
    npx skills add https://github.com/synthetic-sciences/openscience --skill "backend/cli/skills/biology/gget"
    Safe inspection promptEditorial

    Inspect the Agent Skill "gget" from https://github.com/synthetic-sciences/openscience/blob/85f1d4650fec6a1b1f37859c885dd5948a5f90c7/backend/cli/skills/biology/gget/SKILL.md at commit 85f1d4650fec6a1b1f37859c885dd5948a5f90c7. List every install step, command, network request, credential, file read/write, external action, and rollback step. Explain whether it fits my task. Do not install or execute anything until I approve.

    Workflow

    What the source asks the agent to do

    1. 01

      Quick Start

      Basic usage pattern for all modules:

      Basic usage pattern for all modules:
    2. 02

      Then setup AlphaFold

      gget setup alphafold bash

      gget setup alphafold bash
    3. 03

      gget setup - Install Dependencies

      Install/download third-party dependencies for specific modules.

      module: Module name requiring dependency installation-o/--out: Output folder path (elm module only)alphafold - Downloads 4GB of model parameters
    4. 04

      Setup AlphaFold

      Review the “Setup AlphaFold” section in the pinned source before continuing.

      Review and apply the “Setup AlphaFold” source section.
    5. 05

      Setup ELM with custom directory

      gget setup elm -o /path/to/elmdata python

      gget setup elm -o /path/to/elmdata python

    Permission review

    Static risk signals and limitations

    Runs scripts

    medium · line 33

    The documentation asks the agent to run terminal commands or scripts.

    # Python

    Writes files

    medium · line 42

    The documentation asks the agent to create, modify, or delete local files.

    `-o/--out`: Save results to file

    Writes files

    medium · line 846

    The documentation asks the agent to create, modify, or delete local files.

    Save to file: Add `save=True` or specify `out="filename"`

    Evidence record

    Why each signal appears

    EvidenceSourceComputedTestedEditorial
    SignalValueEvidence typeMeaning
    Quality score92/100ComputedDocumentation, specificity, maintenance, and trust rules
    Repository stars3,352SourceRepository attention, not individual Skill quality
    Compatibility0 platformsSourceDeclared in the catalog source record
    Usage guideautomated source guideEditorialGenerated or reviewed according to the visible evidence level

    Pinned source

    Provenance and original SKILL.md

    Repository
    synthetic-sciences/openscience
    Skill path
    backend/cli/skills/biology/gget/SKILL.md
    Commit
    85f1d4650fec6a1b1f37859c885dd5948a5f90c7
    License
    Apache-2.0
    Collected
    2026-08-28
    Default branch
    main
    View the original SKILL.md

    gget

    Overview

    gget is a command-line bioinformatics tool and Python package providing unified access to 20+ genomic databases and analysis methods. Query gene information, sequence analysis, protein structures, expression data, and disease associations through a consistent interface. All gget modules work both as command-line tools and as Python functions.

    Important: The databases queried by gget are continuously updated, which sometimes changes their structure. gget modules are tested automatically on a biweekly basis and updated to match new database structures when necessary.

    Installation

    Install gget in a clean virtual environment to avoid conflicts:

    # Using uv (recommended)
    uv uv pip install gget
    
    # Or using pip
    uv pip install --upgrade gget
    
    # In Python/Jupyter
    import gget
    

    Quick Start

    Basic usage pattern for all modules:

    # Command-line
    gget <module> [arguments] [options]
    
    # Python
    gget.module(arguments, options)
    

    Most modules return:

    • Command-line: JSON (default) or CSV with -csv flag
    • Python: DataFrame or dictionary

    Common flags across modules:

    • -o/--out: Save results to file
    • -q/--quiet: Suppress progress information
    • -csv: Return CSV format (command-line only)

    Module Categories

    1. Reference & Gene Information

    gget ref - Reference Genome Downloads

    Retrieve download links and metadata for Ensembl reference genomes.

    Parameters:

    • species: Genus_species format (e.g., 'homo_sapiens', 'mus_musculus'). Shortcuts: 'human', 'mouse'
    • -w/--which: Specify return types (gtf, cdna, dna, cds, cdrna, pep). Default: all
    • -r/--release: Ensembl release number (default: latest)
    • -l/--list_species: List available vertebrate species
    • -liv/--list_iv_species: List available invertebrate species
    • -ftp: Return only FTP links
    • -d/--download: Download files (requires curl)

    Examples:

    # List available species
    gget ref --list_species
    
    # Get all reference files for human
    gget ref homo_sapiens
    
    # Download only GTF annotation for mouse
    gget ref -w gtf -d mouse
    
    # Python
    gget.ref("homo_sapiens")
    gget.ref("mus_musculus", which="gtf", download=True)
    

    gget search - Gene Search

    Locate genes by name or description across species.

    Parameters:

    • searchwords: One or more search terms (case-insensitive)
    • -s/--species: Target species (e.g., 'homo_sapiens', 'mouse')
    • -r/--release: Ensembl release number
    • -t/--id_type: Return 'gene' (default) or 'transcript'
    • -ao/--andor: 'or' (default) finds ANY searchword; 'and' requires ALL
    • -l/--limit: Maximum results to return

    Returns: ensembl_id, gene_name, ensembl_description, ext_ref_description, biotype, URL

    Examples:

    # Search for GABA-related genes in human
    gget search -s human gaba gamma-aminobutyric
    
    # Find specific gene, require all terms
    gget search -s mouse -ao and pax7 transcription
    
    # Python
    gget.search(["gaba", "gamma-aminobutyric"], species="homo_sapiens")
    

    gget info - Gene/Transcript Information

    Retrieve comprehensive gene and transcript metadata from Ensembl, UniProt, and NCBI.

    Parameters:

    • ens_ids: One or more Ensembl IDs (also supports WormBase, Flybase IDs). Limit: ~1000 IDs
    • -n/--ncbi: Disable NCBI data retrieval
    • -u/--uniprot: Disable UniProt data retrieval
    • -pdb: Include PDB identifiers (increases runtime)

    Returns: UniProt ID, NCBI gene ID, primary gene name, synonyms, protein names, descriptions, biotype, canonical transcript

    Examples:

    # Get info for multiple genes
    gget info ENSG00000034713 ENSG00000104853 ENSG00000170296
    
    # Include PDB IDs
    gget info ENSG00000034713 -pdb
    
    # Python
    gget.info(["ENSG00000034713", "ENSG00000104853"], pdb=True)
    

    gget seq - Sequence Retrieval

    Fetch nucleotide or amino acid sequences for genes and transcripts.

    Parameters:

    • ens_ids: One or more Ensembl identifiers
    • -t/--translate: Fetch amino acid sequences instead of nucleotide
    • -iso/--isoforms: Return all transcript variants (gene IDs only)

    Returns: FASTA format sequences

    Examples:

    # Get nucleotide sequences
    gget seq ENSG00000034713 ENSG00000104853
    
    # Get all protein isoforms
    gget seq -t -iso ENSG00000034713
    
    # Python
    gget.seq(["ENSG00000034713"], translate=True, isoforms=True)
    

    2. Sequence Analysis & Alignment

    gget blast - BLAST Searches

    BLAST nucleotide or amino acid sequences against standard databases.

    Parameters:

    • sequence: Sequence string or path to FASTA/.txt file
    • -p/--program: blastn, blastp, blastx, tblastn, tblastx (auto-detected)
    • -db/--database:
      • Nucleotide: nt, refseq_rna, pdbnt
      • Protein: nr, swissprot, pdbaa, refseq_protein
    • -l/--limit: Max hits (default: 50)
    • -e/--expect: E-value cutoff (default: 10.0)
    • -lcf/--low_comp_filt: Enable low complexity filtering
    • -mbo/--megablast_off: Disable MegaBLAST (blastn only)

    Examples:

    # BLAST protein sequence
    gget blast MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR
    
    # BLAST from file with specific database
    gget blast sequence.fasta -db swissprot -l 10
    
    # Python
    gget.blast("MKWMFK...", database="swissprot", limit=10)
    

    gget blat - BLAT Searches

    Locate genomic positions of sequences using UCSC BLAT.

    Parameters:

    • sequence: Sequence string or path to FASTA/.txt file
    • -st/--seqtype: 'DNA', 'protein', 'translated%20RNA', 'translated%20DNA' (auto-detected)
    • -a/--assembly: Target assembly (default: 'human'/hg38; options: 'mouse'/mm39, 'zebrafinch'/taeGut2, etc.)

    Returns: genome, query size, alignment positions, matches, mismatches, alignment percentage

    Examples:

    # Find genomic location in human
    gget blat ATCGATCGATCGATCG
    
    # Search in different assembly
    gget blat -a mm39 ATCGATCGATCGATCG
    
    # Python
    gget.blat("ATCGATCGATCGATCG", assembly="mouse")
    

    gget muscle - Multiple Sequence Alignment

    Align multiple nucleotide or amino acid sequences using Muscle5.

    Parameters:

    • fasta: Sequences or path to FASTA/.txt file
    • -s5/--super5: Use Super5 algorithm for faster processing (large datasets)

    Returns: Aligned sequences in ClustalW format or aligned FASTA (.afa)

    Examples:

    # Align sequences from file
    gget muscle sequences.fasta -o aligned.afa
    
    # Use Super5 for large dataset
    gget muscle large_dataset.fasta -s5
    
    # Python
    gget.muscle("sequences.fasta", save=True)
    

    gget diamond - Local Sequence Alignment

    Perform fast local protein or translated DNA alignment using DIAMOND.

    Parameters:

    • Query: Sequences (string/list) or FASTA file path
    • --reference: Reference sequences (string/list) or FASTA file path (required)
    • --sensitivity: fast, mid-sensitive, sensitive, more-sensitive, very-sensitive (default), ultra-sensitive
    • --threads: CPU threads (default: 1)
    • --diamond_db: Save database for reuse
    • --translated: Enable nucleotide-to-amino acid alignment

    Returns: Identity percentage, sequence lengths, match positions, gap openings, E-values, bit scores

    Examples:

    # Align against reference
    gget diamond GGETISAWESQME -ref reference.fasta --threads 4
    
    # Save database for reuse
    gget diamond query.fasta -ref ref.fasta --diamond_db my_db.dmnd
    
    # Python
    gget.diamond("GGETISAWESQME", reference="reference.fasta", threads=4)
    

    3. Structural & Protein Analysis

    gget pdb - Protein Structures

    Query RCSB Protein Data Bank for structure and metadata.

    Parameters:

    • pdb_id: PDB identifier (e.g., '7S7U')
    • -r/--resource: Data type (pdb, entry, pubmed, assembly, entity types)
    • -i/--identifier: Assembly, entity, or chain ID

    Returns: PDB format (structures) or JSON (metadata)

    Examples:

    # Download PDB structure
    gget pdb 7S7U -o 7S7U.pdb
    
    # Get metadata
    gget pdb 7S7U -r entry
    
    # Python
    gget.pdb("7S7U", save=True)
    

    gget alphafold - Protein Structure Prediction

    Predict 3D protein structures using simplified AlphaFold2.

    Setup Required:

    # Install OpenMM first
    uv pip install openmm
    
    # Then setup AlphaFold
    gget setup alphafold
    

    Parameters:

    • sequence: Amino acid sequence (string), multiple sequences (list), or FASTA file. Multiple sequences trigger multimer modeling
    • -mr/--multimer_recycles: Recycling iterations (default: 3; recommend 20 for accuracy)
    • -mfm/--multimer_for_monomer: Apply multimer model to single proteins
    • -r/--relax: AMBER relaxation for top-ranked model
    • plot: Python-only; generate interactive 3D visualization (default: True)
    • show_sidechains: Python-only; include side chains (default: True)

    Returns: PDB structure file, JSON alignment error data, optional 3D visualization

    Examples:

    # Predict single protein structure
    gget alphafold MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR
    
    # Predict multimer with higher accuracy
    gget alphafold sequence1.fasta -mr 20 -r
    
    # Python with visualization
    gget.alphafold("MKWMFK...", plot=True, show_sidechains=True)
    
    # Multimer prediction
    gget.alphafold(["sequence1", "sequence2"], multimer_recycles=20)
    

    gget elm - Eukaryotic Linear Motifs

    Predict Eukaryotic Linear Motifs in protein sequences.

    Setup Required:

    gget setup elm
    

    Parameters:

    • sequence: Amino acid sequence or UniProt Acc
    • -u/--uniprot: Indicates sequence is UniProt Acc
    • -e/--expand: Include protein names, organisms, references
    • -s/--sensitivity: DIAMOND alignment sensitivity (default: "very-sensitive")
    • -t/--threads: Number of threads (default: 1)

    Returns: Two outputs:

    1. ortholog_df: Linear motifs from orthologous proteins
    2. regex_df: Motifs directly matched in input sequence

    Examples:

    # Predict motifs from sequence
    gget elm LIAQSIGQASFV -o results
    
    # Use UniProt accession with expanded info
    gget elm --uniprot Q02410 -e
    
    # Python
    ortholog_df, regex_df = gget.elm("LIAQSIGQASFV")
    

    4. Expression & Disease Data

    gget archs4 - Gene Correlation & Tissue Expression

    Query ARCHS4 database for correlated genes or tissue expression data.

    Parameters:

    • gene: Gene symbol or Ensembl ID (with --ensembl flag)
    • -w/--which: 'correlation' (default, returns 100 most correlated genes) or 'tissue' (expression atlas)
    • -s/--species: 'human' (default) or 'mouse' (tissue data only)
    • -e/--ensembl: Input is Ensembl ID

    Returns:

    • Correlation mode: Gene symbols, Pearson correlation coefficients
    • Tissue mode: Tissue identifiers, min/Q1/median/Q3/max expression values

    Examples:

    # Get correlated genes
    gget archs4 ACE2
    
    # Get tissue expression
    gget archs4 -w tissue ACE2
    
    # Python
    gget.archs4("ACE2", which="tissue")
    

    gget cellxgene - Single-Cell RNA-seq Data

    Query CZ CELLxGENE Discover Census for single-cell data.

    Setup Required:

    gget setup cellxgene
    

    Parameters:

    • --gene (-g): Gene names or Ensembl IDs (case-sensitive! 'PAX7' for human, 'Pax7' for mouse)
    • --tissue: Tissue type(s)
    • --cell_type: Specific cell type(s)
    • --species (-s): 'homo_sapiens' (default) or 'mus_musculus'
    • --census_version (-cv): Version ("stable", "latest", or dated)
    • --ensembl (-e): Use Ensembl IDs
    • --meta_only (-mo): Return metadata only
    • Additional filters: disease, development_stage, sex, assay, dataset_id, donor_id, ethnicity, suspension_type

    Returns: AnnData object with count matrices and metadata (or metadata-only dataframes)

    Examples:

    # Get single-cell data for specific genes and cell types
    gget cellxgene --gene ACE2 ABCA1 --tissue lung --cell_type "mucus secreting cell" -o lung_data.h5ad
    
    # Metadata only
    gget cellxgene --gene PAX7 --tissue muscle --meta_only -o metadata.csv
    
    # Python
    adata = gget.cellxgene(gene=["ACE2", "ABCA1"], tissue="lung", cell_type="mucus secreting cell")
    

    gget enrichr - Enrichment Analysis

    Perform ontology enrichment analysis on gene lists using Enrichr.

    Parameters:

    • genes: Gene symbols or Ensembl IDs
    • -db/--database: Reference database (supports shortcuts: 'pathway', 'transcription', 'ontology', 'diseases_drugs', 'celltypes')
    • -s/--species: human (default), mouse, fly, yeast, worm, fish
    • -bkg_l/--background_list: Background genes for comparison
    • -ko/--kegg_out: Save KEGG pathway images with highlighted genes
    • plot: Python-only; generate graphical results

    Database Shortcuts:

    • 'pathway' → KEGG_2021_Human
    • 'transcription' → ChEA_2016
    • 'ontology' → GO_Biological_Process_2021
    • 'diseases_drugs' → GWAS_Catalog_2019
    • 'celltypes' → PanglaoDB_Augmented_2021

    Examples:

    # Enrichment analysis for ontology
    gget enrichr -db ontology ACE2 AGT AGTR1
    
    # Save KEGG pathways
    gget enrichr -db pathway ACE2 AGT AGTR1 -ko ./kegg_images/
    
    # Python with plot
    gget.enrichr(["ACE2", "AGT", "AGTR1"], database="ontology", plot=True)
    

    gget bgee - Orthology & Expression

    Retrieve orthology and gene expression data from Bgee database.

    Parameters:

    • ens_id: Ensembl gene ID or NCBI gene ID (for non-Ensembl species). Multiple IDs supported when type=expression
    • -t/--type: 'orthologs' (default) or 'expression'

    Returns:

    • Orthologs mode: Matching genes across species with IDs, names, taxonomic info
    • Expression mode: Anatomical entities, confidence scores, expression status

    Examples:

    # Get orthologs
    gget bgee ENSG00000169194
    
    # Get expression data
    gget bgee ENSG00000169194 -t expression
    
    # Multiple genes
    gget bgee ENSBTAG00000047356 ENSBTAG00000018317 -t expression
    
    # Python
    gget.bgee("ENSG00000169194", type="orthologs")
    

    gget opentargets - Disease & Drug Associations

    Retrieve disease and drug associations from OpenTargets.

    Parameters:

    • Ensembl gene ID (required)
    • -r/--resource: diseases (default), drugs, tractability, pharmacogenetics, expression, depmap, interactions
    • -l/--limit: Cap results count
    • Filter arguments (vary by resource):
      • drugs: --filter_disease
      • pharmacogenetics: --filter_drug
      • expression/depmap: --filter_tissue, --filter_anat_sys, --filter_organ
      • interactions: --filter_protein_a, --filter_protein_b, --filter_gene_b

    Examples:

    # Get associated diseases
    gget opentargets ENSG00000169194 -r diseases -l 5
    
    # Get associated drugs
    gget opentargets ENSG00000169194 -r drugs -l 10
    
    # Get tissue expression
    gget opentargets ENSG00000169194 -r expression --filter_tissue brain
    
    # Python
    gget.opentargets("ENSG00000169194", resource="diseases", limit=5)
    

    gget cbio - cBioPortal Cancer Genomics

    Plot cancer genomics heatmaps using cBioPortal data.

    Two subcommands:

    search - Find study IDs:

    gget cbio search breast lung
    

    plot - Generate heatmaps:

    Parameters:

    • -s/--study_ids: Space-separated cBioPortal study IDs (required)
    • -g/--genes: Space-separated gene names or Ensembl IDs (required)
    • -st/--stratification: Column to organize data (tissue, cancer_type, cancer_type_detailed, study_id, sample)
    • -vt/--variation_type: Data type (mutation_occurrences, cna_nonbinary, sv_occurrences, cna_occurrences, Consequence)
    • -f/--filter: Filter by column value (e.g., 'study_id:msk_impact_2017')
    • -dd/--data_dir: Cache directory (default: ./gget_cbio_cache)
    • -fd/--figure_dir: Output directory (default: ./gget_cbio_figures)
    • -dpi: Resolution (default: 100)
    • -sh/--show: Display plot in window
    • -nc/--no_confirm: Skip download confirmations

    Examples:

    # Search for studies
    gget cbio search esophag ovary
    
    # Create heatmap
    gget cbio plot -s msk_impact_2017 -g AKT1 ALK BRAF -st tissue -vt mutation_occurrences
    
    # Python
    gget.cbio_search(["esophag", "ovary"])
    gget.cbio_plot(["msk_impact_2017"], ["AKT1", "ALK"], stratification="tissue")
    

    gget cosmic - COSMIC Database

    Search COSMIC (Catalogue Of Somatic Mutations In Cancer) database.

    Important: License fees apply for commercial use. Requires COSMIC account credentials.

    Parameters:

    • searchterm: Gene name, Ensembl ID, mutation notation, or sample ID
    • -ctp/--cosmic_tsv_path: Path to downloaded COSMIC TSV file (required for querying)
    • -l/--limit: Maximum results (default: 100)

    Database download flags:

    • -d/--download_cosmic: Activate download mode
    • -gm/--gget_mutate: Create version for gget mutate
    • -cp/--cosmic_project: Database type (cancer, census, cell_line, resistance, genome_screen, targeted_screen)
    • -cv/--cosmic_version: COSMIC version
    • -gv/--grch_version: Human reference genome (37 or 38)
    • --email, --password: COSMIC credentials

    Examples:

    # First download database
    gget cosmic -d --email user@example.com --password xxx -cp cancer
    
    # Then query
    gget cosmic EGFR -ctp cosmic_data.tsv -l 10
    
    # Python
    gget.cosmic("EGFR", cosmic_tsv_path="cosmic_data.tsv", limit=10)
    

    5. Additional Tools

    gget mutate - Generate Mutated Sequences

    Generate mutated nucleotide sequences from mutation annotations.

    Parameters:

    • sequences: FASTA file path or direct sequence input (string/list)
    • -m/--mutations: CSV/TSV file or DataFrame with mutation data (required)
    • -mc/--mut_column: Mutation column name (default: 'mutation')
    • -sic/--seq_id_column: Sequence ID column (default: 'seq_ID')
    • -mic/--mut_id_column: Mutation ID column
    • -k/--k: Length of flanking sequences (default: 30 nucleotides)

    Returns: Mutated sequences in FASTA format

    Examples:

    # Single mutation
    gget mutate ATCGCTAAGCT -m "c.4G>T"
    
    # Multiple sequences with mutations from file
    gget mutate sequences.fasta -m mutations.csv -o mutated.fasta
    
    # Python
    import pandas as pd
    mutations_df = pd.DataFrame({"seq_ID": ["seq1"], "mutation": ["c.4G>T"]})
    gget.mutate(["ATCGCTAAGCT"], mutations=mutations_df)
    

    gget gpt - OpenAI Text Generation

    Generate natural language text using OpenAI's API.

    Setup Required:

    gget setup gpt
    

    Important: Free tier limited to 3 months after account creation. Set monthly billing limits.

    Parameters:

    • prompt: Text input for generation (required)
    • api_key: OpenAI authentication (required)
    • Model configuration: temperature, top_p, max_tokens, frequency_penalty, presence_penalty
    • Default model: gpt-3.5-turbo (configurable)

    Examples:

    gget gpt "Explain CRISPR" --api_key your_key_here
    
    # Python
    gget.gpt("Explain CRISPR", api_key="your_key_here")
    

    gget setup - Install Dependencies

    Install/download third-party dependencies for specific modules.

    Parameters:

    • module: Module name requiring dependency installation
    • -o/--out: Output folder path (elm module only)

    Modules requiring setup:

    • alphafold - Downloads ~4GB of model parameters
    • cellxgene - Installs cellxgene-census (may not support latest Python)
    • elm - Downloads local ELM database
    • gpt - Configures OpenAI integration

    Examples:

    # Setup AlphaFold
    gget setup alphafold
    
    # Setup ELM with custom directory
    gget setup elm -o /path/to/elm_data
    
    # Python
    gget.setup("alphafold")
    

    Common Workflows

    Workflow 1: Gene Discovery to Sequence Analysis

    Find and analyze genes of interest:

    # 1. Search for genes
    results = gget.search(["GABA", "receptor"], species="homo_sapiens")
    
    # 2. Get detailed information
    gene_ids = results["ensembl_id"].tolist()
    info = gget.info(gene_ids[:5])
    
    # 3. Retrieve sequences
    sequences = gget.seq(gene_ids[:5], translate=True)
    

    Workflow 2: Sequence Alignment and Structure

    Align sequences and predict structures:

    # 1. Align multiple sequences
    alignment = gget.muscle("sequences.fasta")
    
    # 2. Find similar sequences
    blast_results = gget.blast(my_sequence, database="swissprot", limit=10)
    
    # 3. Predict structure
    structure = gget.alphafold(my_sequence, plot=True)
    
    # 4. Find linear motifs
    ortholog_df, regex_df = gget.elm(my_sequence)
    

    Workflow 3: Gene Expression and Enrichment

    Analyze expression patterns and functional enrichment:

    # 1. Get tissue expression
    tissue_expr = gget.archs4("ACE2", which="tissue")
    
    # 2. Find correlated genes
    correlated = gget.archs4("ACE2", which="correlation")
    
    # 3. Get single-cell data
    adata = gget.cellxgene(gene=["ACE2"], tissue="lung", cell_type="epithelial cell")
    
    # 4. Perform enrichment analysis
    gene_list = correlated["gene_symbol"].tolist()[:50]
    enrichment = gget.enrichr(gene_list, database="ontology", plot=True)
    

    Workflow 4: Disease and Drug Analysis

    Investigate disease associations and therapeutic targets:

    # 1. Search for genes
    genes = gget.search(["breast cancer"], species="homo_sapiens")
    
    # 2. Get disease associations
    diseases = gget.opentargets("ENSG00000169194", resource="diseases")
    
    # 3. Get drug associations
    drugs = gget.opentargets("ENSG00000169194", resource="drugs")
    
    # 4. Query cancer genomics data
    study_ids = gget.cbio_search(["breast"])
    gget.cbio_plot(study_ids[:2], ["BRCA1", "BRCA2"], stratification="cancer_type")
    
    # 5. Search COSMIC for mutations
    cosmic_results = gget.cosmic("BRCA1", cosmic_tsv_path="cosmic.tsv")
    

    Workflow 5: Comparative Genomics

    Compare proteins across species:

    # 1. Get orthologs
    orthologs = gget.bgee("ENSG00000169194", type="orthologs")
    
    # 2. Get sequences for comparison
    human_seq = gget.seq("ENSG00000169194", translate=True)
    mouse_seq = gget.seq("ENSMUSG00000026091", translate=True)
    
    # 3. Align sequences
    alignment = gget.muscle([human_seq, mouse_seq])
    
    # 4. Compare structures
    human_structure = gget.pdb("7S7U")
    mouse_structure = gget.alphafold(mouse_seq)
    

    Workflow 6: Building Reference Indices

    Prepare reference data for downstream analysis (e.g., kallisto|bustools):

    # 1. List available species
    gget ref --list_species
    
    # 2. Download reference files
    gget ref -w gtf -w cdna -d homo_sapiens
    
    # 3. Build kallisto index
    kallisto index -i transcriptome.idx transcriptome.fasta
    
    # 4. Download genome for alignment
    gget ref -w dna -d homo_sapiens
    

    Best Practices

    Data Retrieval

    • Use --limit to control result sizes for large queries
    • Save results with -o/--out for reproducibility
    • Check database versions/releases for consistency across analyses
    • Use --quiet in production scripts to reduce output

    Sequence Analysis

    • For BLAST/BLAT, start with default parameters, then adjust sensitivity
    • Use gget diamond with --threads for faster local alignment
    • Save DIAMOND databases with --diamond_db for repeated queries
    • For multiple sequence alignment, use -s5/--super5 for large datasets

    Expression and Disease Data

    • Gene symbols are case-sensitive in cellxgene (e.g., 'PAX7' vs 'Pax7')
    • Run gget setup before first use of alphafold, cellxgene, elm, gpt
    • For enrichment analysis, use database shortcuts for convenience
    • Cache cBioPortal data with -dd to avoid repeated downloads

    Structure Prediction

    • AlphaFold multimer predictions: use -mr 20 for higher accuracy
    • Use -r flag for AMBER relaxation of final structures
    • Visualize results in Python with plot=True
    • Check PDB database first before running AlphaFold predictions

    Error Handling

    • Database structures change; update gget regularly: uv pip install --upgrade gget
    • Process max ~1000 Ensembl IDs at once with gget info
    • For large-scale analyses, implement rate limiting for API queries
    • Use virtual environments to avoid dependency conflicts

    Output Formats

    Command-line

    • Default: JSON
    • CSV: Add -csv flag
    • FASTA: gget seq, gget mutate
    • PDB: gget pdb, gget alphafold
    • PNG: gget cbio plot

    Python

    • Default: DataFrame or dictionary
    • JSON: Add json=True parameter
    • Save to file: Add save=True or specify out="filename"
    • AnnData: gget cellxgene

    Resources

    This skill includes reference documentation for detailed module information:

    references/

    • module_reference.md - Comprehensive parameter reference for all modules
    • database_info.md - Information about queried databases and their update frequencies
    • workflows.md - Extended workflow examples and use cases

    For additional help:

    Frequently asked questions

    What to verify before installation and use

    What does the gget source document cover?

    Fast CLI/Python queries to 20+ bioinformatics databases. Use for quick lookups: gene info, BLAST searches, AlphaFold structures, enrichment analysis.

    How do I install gget?

    The source record exposes this install command: npx skills add https://github.com/synthetic-sciences/openscience --skill "backend/cli/skills/biology/gget". Inspect the command and pinned source before running it.

    Which permission-related actions were detected?

    Static rules flagged exec-script, write-files in the source; the page lists the matching lines and excerpts.

    Alternatives

    Compare before choosing

    Computed 94243,902

    affaan-m/ECC

    gget

    gget CLI and Python workflow for quick genomic database queries, sequence lookup, BLAST-style searches, enrichment checks, and reproducible bioinformatics evidence logs. Use when a task needs quick bioinformatics lookup across genomic reference databases with the gget CLI or Python package.

    Computed 9836,049

    K-Dense-AI/scientific-agent-skills

    dask

    Distributed computing for larger-than-RAM pandas/NumPy workflows. Use when you need to scale existing pandas/NumPy code beyond memory or across clusters. Best for parallel file processing, distributed ML, integration with existing pandas code. For out-of-core analytics on single machine use vaex; for in-memory speed use polars.

    Computed 9836,049

    K-Dense-AI/scientific-agent-skills

    neurokit2

    Use NeuroKit2 to build or audit reproducible research workflows for physiological time-series preprocessing, event/interval analysis, multimodal alignment, variability, and complexity. Trigger when code imports neurokit2 or needs its current APIs, schemas, and method-aware validation—not for diagnosis or device validation.

    Computed 986,897

    trailofbits/skills

    constant-time-analysis

    Detects timing side-channel vulnerabilities in cryptographic code. Use when implementing or reviewing crypto code, encountering division on secrets, secret-dependent branches, or constant-time programming questions in C, C++, Go, Rust, Swift, Java, Kotlin, C#, PHP, JavaScript, TypeScript, Python, or Ruby.